Lineage for d1q3oa_ (1q3o A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (7 families) 
peptide-binding domainFamily b.36.1.1: PDZ domain [50157] (47 proteins)
Pfam PF00595
Protein Shank1, PDZ domain [101733] (2 species)
SH3 and multiple ankyrin repeat domains protein 1Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (5 PDB entries) 
Domain d1q3oa_: 1q3o A: [95700]
complexed with br
Details for d1q3oa_
PDB Entry: 1q3o (more details), 1.8 Å
PDB Description: Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
PDB Compounds: (A:) Shank1SCOPe Domain Sequences for d1q3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrh
SCOPe Domain Coordinates for d1q3oa_:
Click to download the PDB-style file with coordinates for d1q3oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q3oa_:
- d1q3oa_ first appeared in SCOP 1.67
- d1q3oa_ appears in SCOPe 2.06
- d1q3oa_ appears in the current release, SCOPe 2.08
View in 3D
