Lineage for d1q3ea_ (1q3e A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein HCN pacemaker channel [101993] (1 species)
potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channelSpecies Mouse (Mus musculus) [TaxId:10090] [101994] (5 PDB entries) 
Domain d1q3ea_: 1q3e A: [95669]
complexed with pcg
Details for d1q3ea_
PDB Entry: 1q3e (more details), 1.9 Å
PDB Description: HCN2J 443-645 in the presence of cGMP
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2SCOPe Domain Sequences for d1q3ea_:
Sequence, based on SEQRES records: (download)
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldr
Sequence, based on observed residues (ATOM records): (download)
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrr
afetvaidrldr
SCOPe Domain Coordinates for d1q3ea_:
Click to download the PDB-style file with coordinates for d1q3ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q3ea_:
- d1q3ea_ first appeared in SCOP 1.67
- d1q3ea_ appears in SCOPe 2.02
- d1q3ea_ appears in SCOPe 2.04
- d1q3ea_ appears in the current release, SCOPe 2.08
View in 3D
