Lineage for d1q1fa_ (1q1f A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255602Protein Neuroglobin [100978] (2 species)
  7. 1255609Species Mouse (Mus musculus) [TaxId:10090] [109625] (5 PDB entries)
    Uniprot Q9ER97
  8. 1255610Domain d1q1fa_: 1q1f A: [104476]
    complexed with hem

Details for d1q1fa_

PDB Entry: 1q1f (more details), 1.5 Å

PDB Description: crystal structure of murine neuroglobin
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d1q1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

SCOPe Domain Coordinates for d1q1fa_:

Click to download the PDB-style file with coordinates for d1q1fa_.
(The format of our PDB-style files is described here.)

Timeline for d1q1fa_: