Lineage for d1q12a2 (1q12 A:4-235)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989641Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 989753Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 989754Species Escherichia coli [TaxId:562] [102380] (6 PDB entries)
  8. 989759Domain d1q12a2: 1q12 A:4-235 [95530]
    Other proteins in same PDB: d1q12a1, d1q12b1, d1q12c1, d1q12d1
    complexed with atp

Details for d1q12a2

PDB Entry: 1q12 (more details), 2.6 Å

PDB Description: Crystal Structure of the ATP-bound E. coli MalK
PDB Compounds: (A:) Maltose/maltodextrin transport ATP-binding protein malK

SCOPe Domain Sequences for d1q12a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q12a2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig
ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql
ahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrl
grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d1q12a2:

Click to download the PDB-style file with coordinates for d1q12a2.
(The format of our PDB-style files is described here.)

Timeline for d1q12a2: