![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Probable DEAD box RNA helicase YqfR [102383] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [102384] (1 PDB entry) |
![]() | Domain d1q0ua_: 1q0u A: [95512] N-terminal domain only |
PDB Entry: 1q0u (more details), 1.85 Å
SCOPe Domain Sequences for d1q0ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} tqftrfpfqpfiieaiktlrfykpteiqeriipgalrgesmvgqsqtgtgkthayllpim ekikperaevqavitaptrelatqiyhetlkitkfcpkdrmivarcliggtdkqkalekl nvqphivigtpgrindfireqaldvhtahilvvdeadlmldmgfitdvdqiaarmpkdlq mlvfsatipeklkpflkkymenptfvhvl
Timeline for d1q0ua_: