Lineage for d1q05b_ (1q05 B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is differentSuperfamily a.6.1: Putative DNA-binding domain [46955] (8 families) 
Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
includes a dimerisation, antiparallel coiled-coil subdomain
Protein Transcriptional regulator CueR [101073] (1 species)
copper efflux regulatorSpecies Escherichia coli [TaxId:562] [101074] (3 PDB entries) 
Domain d1q05b_: 1q05 B: [95492]
complexed with cu1
Details for d1q05b_
PDB Entry: 1q05 (more details), 2.2 Å
PDB Description: Crystal structure of the Cu(I) form of E. coli CueR, a copper efflux regulator
PDB Compounds: (B:) Transcriptional regulator cueRSCOPe Domain Sequences for d1q05b_:
Sequence, based on SEQRES records: (download)
>d1q05b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqrhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadc
piienlsg
Sequence, based on observed residues (ATOM records): (download)
>d1q05b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadcp
iienlsg
SCOPe Domain Coordinates for d1q05b_:
Click to download the PDB-style file with coordinates for d1q05b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q05b_:
- d1q05b_ first appeared in SCOP 1.67
- d1q05b_ appears in SCOPe 2.07
View in 3D
