Lineage for d1pzxb_ (1pzx B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) 
domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
Family c.119.1.1: DegV-like [82550] (2 proteins)
Pfam PF02645, DUF194
Protein Hypothetical protein apc36103 [102686] (1 species)
lipid-binding protein; Bacilus subtilis YitS orthologSpecies Bacillus stearothermophilus [TaxId:1422] [102687] (1 PDB entry) 
Domain d1pzxb_: 1pzx B: [95485]
structural genomics
complexed with plm
Details for d1pzxb_
PDB Entry: 1pzx (more details), 2 Å
PDB Description: hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein
PDB Compounds: (B:) Hypothetical protein APC36103SCOPe Domain Sequences for d1pzxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzxb_ c.119.1.1 (B:) Hypothetical protein apc36103 {Bacillus stearothermophilus [TaxId: 1422]}
nampieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtv
ktaqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiid
skcaslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggriskt
aaafggllnikpllhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishadd
eetalelkqmieethgctrfflsdigsaigahagpgtialfflnkyiei
SCOPe Domain Coordinates for d1pzxb_:
Click to download the PDB-style file with coordinates for d1pzxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pzxb_:
- d1pzxb_ first appeared in SCOP 1.67
- d1pzxb_ appears in SCOPe 2.03
- d1pzxb_ appears in SCOPe 2.05
- d1pzxb_ appears in the current release, SCOPe 2.08
View in 3D
