![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
![]() | Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [101250] (1 PDB entry) |
![]() | Domain d1pzna1: 1pzn A:35-95 [95456] Other proteins in same PDB: d1pzna2, d1pznb1, d1pznc1, d1pznd1, d1pzne1, d1pznf1, d1pzng1 disordered in the other chains of this PDB entry complexed with gol, imd, mpd, so4 |
PDB Entry: 1pzn (more details), 2.85 Å
SCOPe Domain Sequences for d1pzna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]} rsiedlpgvgpataeklreagydtleaiavaspielkevagisegtalkiiqaarkaanl g
Timeline for d1pzna1: