![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Ornithine transcarbamoylase [53676] (6 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [53679] (2 PDB entries) |
![]() | Domain d1pvva1: 1pvv A:1-150 [95190] complexed with so4 |
PDB Entry: 1pvv (more details), 1.87 Å
SCOPe Domain Sequences for d1pvva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvva1 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Pyrococcus furiosus [TaxId: 2261]} vvslagrdllclqdytaeeiwtiletakmfkiwqkigkphrllegktlamifqkpstrtr vsfevamahlgghalylnaqdlqlrrgetiadtarvlsryvdaimarvydhkdvedlaky atvpvinglsdfshpcqaladymtiwekkg
Timeline for d1pvva1: