![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.12: Sporulation inhibitor Sda [100985] (1 family) ![]() automatically mapped to Pfam PF08970 |
![]() | Family a.2.12.1: Sporulation inhibitor Sda [100986] (2 proteins) |
![]() | Protein Sporulation inhibitor Sda [100987] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [100988] (1 PDB entry) |
![]() | Domain d1pv0a_: 1pv0 A: [95141] |
PDB Entry: 1pv0 (more details)
SCOPe Domain Sequences for d1pv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pv0a_ a.2.12.1 (A:) Sporulation inhibitor Sda {Bacillus subtilis [TaxId: 1423]} mrklsdelliesyfkatemnlnrdfielieneikrrslghiisvss
Timeline for d1pv0a_: