Lineage for d1pumb2 (1pum B:138-263)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) 
Family b.42.2.1: Ricin B-like [50371] (11 proteins) 
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
duplication: consists of two domains of this foldSpecies European mistletoe (Viscum album) [TaxId:3972] [50375] (14 PDB entries)
different sequence variants
Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
Domain d1pumb2: 1pum B:138-263 [104316]
Other proteins in same PDB: d1puma_
complexed with cl, gal, gol, nag, so4
Details for d1pumb2
PDB Entry: 1pum (more details), 2.3 Å
PDB Description: mistletoe lectin i in complex with galactose
PDB Compounds: (B:) lectin I B chainSCOPe Domain Sequences for d1pumb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pumb2 b.42.2.1 (B:138-263) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesaggsvwvetctagqenqrwalygdgsirpkqnqsqcltngrd
svstvinivscsagssgqrwvftnagailnlknglamdvaqanpalariiiypatgnpnq
mwlpvp
SCOPe Domain Coordinates for d1pumb2:
Click to download the PDB-style file with coordinates for d1pumb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pumb2:
- d1pumb2 first appeared in SCOP 1.69
- d1pumb2 appears in SCOPe 2.01
- d1pumb2 appears in SCOPe 2.03
- d1pumb2 appears in the current release, SCOPe 2.08
View in 3D
