Lineage for d1pufb_ (1puf B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761141Family a.4.1.1: Homeodomain [46690] (40 proteins)
    Pfam PF00046
  6. 761290Protein pbx1 [46711] (2 species)
  7. 761291Species Human (Homo sapiens) [TaxId:9606] [46712] (2 PDB entries)
  8. 761292Domain d1pufb_: 1puf B: [95132]
    Other proteins in same PDB: d1pufa_

Details for d1pufb_

PDB Entry: 1puf (more details), 1.9 Å

PDB Description: Crystal Structure of HoxA9 and Pbx1 homeodomains bound to DNA
PDB Compounds: (B:) Pre-B-cell leukemia transcription factor-1

SCOP Domain Sequences for d1pufb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]}
arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk
knigkfqeeaniy

SCOP Domain Coordinates for d1pufb_:

Click to download the PDB-style file with coordinates for d1pufb_.
(The format of our PDB-style files is described here.)

Timeline for d1pufb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pufa_