Lineage for d1pt1a_ (1pt1 A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
Superfamily b.52.2: ADC-like [50692] (4 families) 
Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins) Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
autocatalytic enzyme
Species Escherichia coli [TaxId:562] [50695] (9 PDB entries) 
Domain d1pt1a_: 1pt1 A: [95084]
unprocessed mutant
complexed with so4
Details for d1pt1a_
PDB Entry: 1pt1 (more details), 1.9 Å
PDB Description: unprocessed pyruvoyl dependent aspartate decarboxylase with histidine 11 mutated to alanine
PDB Compounds: (A:) Aspartate 1-decarboxylaseSCOPe Domain Sequences for d1pt1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pt1a_ b.52.2.1 (A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
gsmirtmlqgklarvkvthadlhyegscaidqdfldaagileneaidiwnvtngkrfsty
aiaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk
SCOPe Domain Coordinates for d1pt1a_:
Click to download the PDB-style file with coordinates for d1pt1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pt1a_:
- d1pt1a_ first appeared in SCOP 1.67
- d1pt1a_ appears in SCOPe 2.02
- d1pt1a_ appears in SCOPe 2.04
- d1pt1a_ appears in the current release, SCOPe 2.08, called d1pt1a1
View in 3D
