![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (12 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
![]() | Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55024] (7 PDB entries) |
![]() | Domain d1psda3: 1psd A:327-410 [39354] Other proteins in same PDB: d1psda1, d1psda2, d1psdb1, d1psdb2 |
PDB Entry: 1psd (more details), 2.75 Å
SCOP Domain Sequences for d1psda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psda3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead edvaekalqamkaipgtirarlly
Timeline for d1psda3: