![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
![]() | Protein Phosphoglycerate dehydrogenase [51839] (2 species) has additional C-terminal domain of the ferredoxin fold |
![]() | Species Escherichia coli [TaxId:562] [51840] (7 PDB entries) |
![]() | Domain d1psda1: 1psd A:108-295 [30097] Other proteins in same PDB: d1psda2, d1psda3, d1psdb2, d1psdb3 complexed with nad, ser |
PDB Entry: 1psd (more details), 2.75 Å
SCOPe Domain Sequences for d1psda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psda1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis lmkpgsllinasrgtvvdipalcdalaskhlagaaidvfptepatnsdpftsplcefdnv lltphigg
Timeline for d1psda1: