Lineage for d1prya_ (1pry A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892887Family c.66.1.3: Fibrillarin homologue [53342] (1 protein)
    automatically mapped to Pfam PF01269
  6. 2892888Protein Fibrillarin homologue [53343] (4 species)
  7. 2892894Species Pyrococcus furiosus [TaxId:2261] [224904] (3 PDB entries)
  8. 2892895Domain d1prya_: 1pry A: [95063]
    structural genomics

Details for d1prya_

PDB Entry: 1pry (more details), 1.97 Å

PDB Description: structure determination of fibrillarin homologue from hyperthermophilic archaeon pyrococcus furiosus (pfu-65527)
PDB Compounds: (A:) fibrillarin-like pre-rRNA processing protein

SCOPe Domain Sequences for d1prya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prya_ c.66.1.3 (A:) Fibrillarin homologue {Pyrococcus furiosus [TaxId: 2261]}
vevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklgaa
ivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpiveer
rniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggygmiavksr
sidvtkepeqvfkeverllseyfevierlnlepyekdhalfvvrkp

SCOPe Domain Coordinates for d1prya_:

Click to download the PDB-style file with coordinates for d1prya_.
(The format of our PDB-style files is described here.)

Timeline for d1prya_: