Lineage for d1pr9a_ (1pr9 A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
Protein Carbonyl reductase [51765] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [102144] (1 PDB entry)
dicarbonyl/L-xylulose reductase
Domain d1pr9a_: 1pr9 A: [95060]
complexed with 2hp, k, nap
Details for d1pr9a_
PDB Entry: 1pr9 (more details), 1.96 Å
PDB Description: human l-xylulose reductase holoenzyme
PDB Compounds: (A:) L-xylulose reductaseSCOPe Domain Sequences for d1pr9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}
melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
fwac
SCOPe Domain Coordinates for d1pr9a_:
Click to download the PDB-style file with coordinates for d1pr9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pr9a_:
- d1pr9a_ first appeared in SCOP 1.67
- d1pr9a_ appears in SCOP 1.75
- d1pr9a_ appears in SCOPe 2.02
- d1pr9a_ appears in the current release, SCOPe 2.08
View in 3D
