Lineage for d1pq4a_ (1pq4 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.92: Chelatase-like [53799] (3 superfamilies)
duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) 
contains a long alpha helical insertion in the interdomain linker
Family c.92.2.2: TroA-like [53811] (6 proteins) 
Protein Periplasmic zinc binding protein ZnuA [102688] (1 species) Species Synechocystis sp. PCC 6803 [TaxId:1148] [102689] (1 PDB entry) 
Domain d1pq4a_: 1pq4 A: [94995]
complexed with zn
Details for d1pq4a_
PDB Entry: 1pq4 (more details), 1.9 Å
PDB Description: Crystal structure of ZnuA
PDB Compounds: (A:) periplasmic binding protein component of an ABC type zinc uptake transporterSCOPe Domain Sequences for d1pq4a_:
Sequence, based on SEQRES records: (download)
>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. PCC 6803 [TaxId: 1148]}
damditvsippqqyflekiggdlvrvsvlvpgnndphtyepkpqqlaalseaeayvligl
gfeqpwleklkaananmklidsaqgitplemekhdhshgeeeghddhshdghdhgsesek
ekakgalmvadphiwlsptlvkrqattiakelaeldpdnrdqyeanlaaflaelerlnqe
lgqilqplpqrkfivfhpswayfardynlvqipievegqepsaqelkqlidtakennltm
vfgetqfstksseaiaaeigagvelldplaadwssnlkavaqkianans
Sequence, based on observed residues (ATOM records): (download)
>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. PCC 6803 [TaxId: 1148]}
damditvsippqqyflekiggdlvrvsvlvpgnndphtyepkpqqlaalseaeayvligl
gfeqpwleklkaananmklidsaqgitplemekmvadphiwlsptlvkrqattiakelae
ldpdnrdqyeanlaaflaelerlnqelgqilqplpqrkfivfhpswayfardynlvqipi
evegqepsaqelkqlidtakennltmvfgetqfstksseaiaaeigagvelldplaadws
snlkavaqkianans
SCOPe Domain Coordinates for d1pq4a_:
Click to download the PDB-style file with coordinates for d1pq4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pq4a_:
- d1pq4a_ first appeared in SCOP 1.67
- d1pq4a_ appears in SCOPe 2.04
- d1pq4a_ appears in SCOPe 2.06
- d1pq4a_ appears in the current release, SCOPe 2.08
View in 3D
