![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Elastase [50536] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50537] (15 PDB entries) |
![]() | Domain d1ppfe_: 1ppf E: [26234] Other proteins in same PDB: d1ppfi_ |
PDB Entry: 1ppf (more details), 1.8 Å
SCOPe Domain Sequences for d1ppfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppfe_ b.47.1.2 (E:) Elastase {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifengydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn glihgiasfvrggcasglypdafapvaqfvnwidsiiq
Timeline for d1ppfe_: