Lineage for d1poy1_ (1poy 1:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162993Protein Spermidine/putrescine-binding protein PotD [53875] (1 species)
  7. 2162994Species Escherichia coli [TaxId:562] [53876] (2 PDB entries)
  8. 2162996Domain d1poy1_: 1poy 1: [35808]
    complexed with spd

Details for d1poy1_

PDB Entry: 1poy (more details), 2.5 Å

PDB Description: spermidine/putrescine-binding protein complexed with spermidine (dimer form)
PDB Compounds: (1:) spermidine/putrescine-binding protein

SCOPe Domain Sequences for d1poy1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poy1_ c.94.1.1 (1:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]}
nntlyfynwteyvppglleqftketgikviystyesnetmyaklktykdgaydlvvpsty
yvdkmrkegmiqkidkskltnfsnldpdmlnkpfdpnndysipyiwgataigvngdavdp
ksvtswadlwkpeykgsllltddarevfqmalrklgysgnttdpkeieaaynelkklmpn
vaafnsdnpanpymegevnlgmiwngsafvarqagtpidvvwpkeggifwmdslaipana
knkegalklinfllrpdvakqvaetigyptpnlaarkllspevandktlypdaetiknge
wqndvgaassiyeeyyqklkagr

SCOPe Domain Coordinates for d1poy1_:

Click to download the PDB-style file with coordinates for d1poy1_.
(The format of our PDB-style files is described here.)

Timeline for d1poy1_: