Lineage for d1poxa1 (1pox A:183-365)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862632Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2862831Protein Pyruvate oxidase [52476] (2 species)
    binds FAD
  7. 2862835Species Lactobacillus plantarum [TaxId:1590] [52477] (8 PDB entries)
  8. 2862836Domain d1poxa1: 1pox A:183-365 [31731]
    Other proteins in same PDB: d1poxa2, d1poxa3, d1poxb2, d1poxb3
    complexed with fad, gol, mg, na, tpp; mutant

Details for d1poxa1

PDB Entry: 1pox (more details), 2.1 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum
PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1poxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poxa1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasannyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

SCOPe Domain Coordinates for d1poxa1:

Click to download the PDB-style file with coordinates for d1poxa1.
(The format of our PDB-style files is described here.)

Timeline for d1poxa1: