Lineage for d1powa2 (1pow A:9-182)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 828802Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 828923Protein Pyruvate oxidase [88729] (2 species)
  7. 828929Species Lactobacillus plantarum [TaxId:1590] [88730] (7 PDB entries)
  8. 828942Domain d1powa2: 1pow A:9-182 [31797]
    Other proteins in same PDB: d1powa1, d1powa3, d1powb1, d1powb3

Details for d1powa2

PDB Entry: 1pow (more details), 2.5 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum
PDB Compounds: (A:) Pyruvate oxidase

SCOP Domain Sequences for d1powa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1powa2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

SCOP Domain Coordinates for d1powa2:

Click to download the PDB-style file with coordinates for d1powa2.
(The format of our PDB-style files is described here.)

Timeline for d1powa2: