Lineage for d1poha_ (1poh A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)
  8. Domain d1poha_: 1poh A: [40553]
    complexed with so4

Details for d1poha_

PDB Entry: 1poh (more details), 2 Å

PDB Description: the 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination
PDB Compounds: (A:) histidine-containing phosphocarrier protein hpr

SCOPe Domain Sequences for d1poha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poha_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d1poha_ are not available.

Timeline for d1poha_: