Lineage for d1pnja_ (1pnj A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310320Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species)
  7. 1310321Species Cow (Bos taurus) [TaxId:9913] [50057] (2 PDB entries)
  8. 1310322Domain d1pnja_: 1pnj A: [24487]

Details for d1pnja_

PDB Entry: 1pnj (more details)

PDB Description: solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
PDB Compounds: (A:) phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain

SCOPe Domain Sequences for d1pnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnja_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Cow (Bos taurus) [TaxId: 9913]}
gsmsaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqeakpeeigwlng
ynettgergdfpgtyveyigrkkisp

SCOPe Domain Coordinates for d1pnja_:

Click to download the PDB-style file with coordinates for d1pnja_.
(The format of our PDB-style files is described here.)

Timeline for d1pnja_: