Lineage for d1pn9a1 (1pn9 A:84-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999003Protein Class delta GST [81355] (6 species)
    formerly a part of class theta enzymes
  7. 1999004Species African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId:7165] [101209] (1 PDB entry)
  8. 1999005Domain d1pn9a1: 1pn9 A:84-209 [94949]
    Other proteins in same PDB: d1pn9a2, d1pn9b2
    complexed with gtx

Details for d1pn9a1

PDB Entry: 1pn9 (more details), 2 Å

PDB Description: Crystal structure of an insect delta-class glutathione S-transferase from a DDT-resistant strain of the malaria vector Anopheles gambiae
PDB Compounds: (A:) Glutathione S-transferase 1-6

SCOPe Domain Sequences for d1pn9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn9a1 a.45.1.1 (A:84-209) Class delta GST {African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId: 7165]}
pkdpqkravvnqrlyfdmgtlyqrfadyhypqifakqpanpenekkmkdavgflntfleg
qeyaagndltiadlslaatiatyevagfdfapypnvaawfarckanapgyalnqagadef
kakfls

SCOPe Domain Coordinates for d1pn9a1:

Click to download the PDB-style file with coordinates for d1pn9a1.
(The format of our PDB-style files is described here.)

Timeline for d1pn9a1:

1999005
d1pn9a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1pn9a2