Lineage for d1plqa2 (1plq A:127-258)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583562Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2583570Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries)
    Uniprot P15873
  8. 2583572Domain d1plqa2: 1plq A:127-258 [41389]
    CASP1
    complexed with hg

Details for d1plqa2

PDB Entry: 1plq (more details), 2.3 Å

PDB Description: crystal structure of the eukaryotic dna polymerase processivity factor pcna
PDB Compounds: (A:) proliferating cell nuclear antigen (pcna)

SCOPe Domain Sequences for d1plqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfndee

SCOPe Domain Coordinates for d1plqa2:

Click to download the PDB-style file with coordinates for d1plqa2.
(The format of our PDB-style files is described here.)

Timeline for d1plqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plqa1