Lineage for d1plqa2 (1plq A:127-258)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetrySuperfamily d.131.1: DNA clamp [55979] (3 families) 
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
duplication: consists of two domains of this foldProtein Proliferating cell nuclear antigen (PCNA) [55989] (6 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (6 PDB entries)
Uniprot P15873
Domain d1plqa2: 1plq A:127-258 [41389]
CASP1
complexed with hg
Details for d1plqa2
PDB Entry: 1plq (more details), 2.3 Å
PDB Description: crystal structure of the eukaryotic dna polymerase processivity factor pcna
PDB Compounds: (A:) proliferating cell nuclear antigen (pcna)SCOPe Domain Sequences for d1plqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfndee
SCOPe Domain Coordinates for d1plqa2:
Click to download the PDB-style file with coordinates for d1plqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1plqa2:
- d1plqa2 first appeared (with stable ids) in SCOP 1.55, called d1plq_2
- d1plqa2 appears in SCOPe 2.03
- d1plqa2 appears in SCOPe 2.05
- d1plqa2 appears in the current release, SCOPe 2.08
View in 3D
