| Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
| Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily) 2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix |
Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) ![]() |
| Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins) |
| Protein Siroheme synthase CysG, domains 2 and 3 [103403] (2 species) |
| Species Salmonella typhimurium [TaxId:90371] [103404] (5 PDB entries) |
| Domain d1pjqa3: 1pjq A:114-215 [94768] Other proteins in same PDB: d1pjqa1, d1pjqa2, d1pjqb1, d1pjqb2 complexed with act, pge, sah |
PDB Entry: 1pjq (more details), 2.21 Å
SCOPe Domain Sequences for d1pjqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjqa3 e.37.1.1 (A:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr
Timeline for d1pjqa3: