Lineage for d1pjpa_ (1pjp A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953342Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 953343Species Human (Homo sapiens) [TaxId:9606] [89344] (7 PDB entries)
  8. 953349Domain d1pjpa_: 1pjp A: [26301]
    complexed with nag, zn

Details for d1pjpa_

PDB Entry: 1pjp (more details), 2.2 Å

PDB Description: the 2.2 a crystal structure of human chymase in complex with succinyl- ala-ala-pro-phe-chloromethylketone
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d1pjpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjpa_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d1pjpa_:

Click to download the PDB-style file with coordinates for d1pjpa_.
(The format of our PDB-style files is described here.)

Timeline for d1pjpa_: