Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.7: Mob1/phocein [101152] (1 family) common fold is elaborated with additional short helices; contains a zinc-binding site automatically mapped to Pfam PF03637 |
Family a.29.7.1: Mob1/phocein [101153] (2 proteins) |
Protein Mob1a [101154] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101155] (1 PDB entry) |
Domain d1pi1a_: 1pi1 A: [94699] complexed with zn |
PDB Entry: 1pi1 (more details), 2 Å
SCOPe Domain Sequences for d1pi1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pi1a_ a.29.7.1 (A:) Mob1a {Human (Homo sapiens) [TaxId: 9606]} meatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagp ryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvakti lkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqeliekl gskdr
Timeline for d1pi1a_: