Lineage for d1pi1a_ (1pi1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1995267Superfamily a.29.7: Mob1/phocein [101152] (1 family) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 1995268Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 1995269Protein Mob1a [101154] (2 species)
  7. 1995272Species Human (Homo sapiens) [TaxId:9606] [101155] (1 PDB entry)
  8. 1995273Domain d1pi1a_: 1pi1 A: [94699]
    complexed with zn

Details for d1pi1a_

PDB Entry: 1pi1 (more details), 2 Å

PDB Description: crystal structure of a human mob1 protein; toward understanding mob- regulated cell cycle pathways.
PDB Compounds: (A:) Mob1A

SCOPe Domain Sequences for d1pi1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pi1a_ a.29.7.1 (A:) Mob1a {Human (Homo sapiens) [TaxId: 9606]}
meatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagp
ryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvakti
lkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqeliekl
gskdr

SCOPe Domain Coordinates for d1pi1a_:

Click to download the PDB-style file with coordinates for d1pi1a_.
(The format of our PDB-style files is described here.)

Timeline for d1pi1a_: