Lineage for d1ph1b_ (1ph1 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789351Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 2789352Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries)
  8. 2789362Domain d1ph1b_: 1ph1 B: [88078]
    Other proteins in same PDB: d1ph1a1, d1ph1a2, d1ph1a3
    protein/DNA complex
    has additional insertions and/or extensions that are not grouped together

Details for d1ph1b_

PDB Entry: 1ph1 (more details), 2.51 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttggggt
PDB Compounds: (B:) Telomere-binding protein beta subunit

SCOPe Domain Sequences for d1ph1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ph1b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]}
pqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkea
vnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqe
rlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvda
givkasaskgdefsdfsfkegntatlkiadifvqekg

SCOPe Domain Coordinates for d1ph1b_:

Click to download the PDB-style file with coordinates for d1ph1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ph1b_: