![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
![]() | Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
![]() | Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
![]() | Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries) |
![]() | Domain d1pema1: 1pem A:13-174 [104127] Other proteins in same PDB: d1pema2 |
PDB Entry: 1pem (more details), 2.99 Å
SCOP Domain Sequences for d1pema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pema1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 602]} tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge
Timeline for d1pema1: