Lineage for d1pdka2 (1pdk A:125-215)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) 
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) 
Protein PapD [49586] (1 species) Species Escherichia coli [TaxId:562] [49587] (14 PDB entries) 
Domain d1pdka2: 1pdk A:125-215 [23204]
Other proteins in same PDB: d1pdka1, d1pdkb_
Details for d1pdka2
PDB Entry: 1pdk (more details), 2.4 Å
PDB Description: papd-papk chaperone-pilus subunit complex from e.coli p pilus
PDB Compounds: (A:) protein (chaperone protein papd)SCOPe Domain Sequences for d1pdka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdka2 b.7.2.1 (A:125-215) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvk
SCOPe Domain Coordinates for d1pdka2:
Click to download the PDB-style file with coordinates for d1pdka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pdka2:
- d1pdka2 first appeared (with stable ids) in SCOP 1.55
- d1pdka2 appears in SCOPe 2.02
- d1pdka2 appears in SCOPe 2.04
- d1pdka2 appears in the current release, SCOPe 2.08
View in 3D
