Lineage for d1pdaa1 (1pda A:3-219)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162941Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain [53854] (1 species)
  7. 2162942Species Escherichia coli [TaxId:562] [53855] (5 PDB entries)
  8. 2162943Domain d1pdaa1: 1pda A:3-219 [35751]
    Other proteins in same PDB: d1pdaa2
    complexed with acy, dpm

Details for d1pdaa1

PDB Entry: 1pda (more details), 1.76 Å

PDB Description: structure of porphobilinogen deaminase reveals a flexible multidomain polymerase with a single catalytic site
PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d1pdaa1:

Sequence, based on SEQRES records: (download)

>d1pdaa1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]}
dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvildtplakvggkglf
vkelevallenradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalpag
sivgtsslrrqcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlglesr
iraalppeislpavgqgavgiecrlddsrtrellaal

Sequence, based on observed residues (ATOM records): (download)

>d1pdaa1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]}
dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvigkglfvkelevall
enradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalpagsivgtsslr
rqcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlglesriraalppei
slpavgqgavgiecrlddsrtrellaal

SCOPe Domain Coordinates for d1pdaa1:

Click to download the PDB-style file with coordinates for d1pdaa1.
(The format of our PDB-style files is described here.)

Timeline for d1pdaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdaa2