Lineage for d1pcva_ (1pcv A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
sandwich; 11 strands in 2 sheetsSuperfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) 
has two smaller insertion domainsFamily b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
automatically mapped to Pfam PF00314
Protein Osmotin [101620] (1 species)
antifungal proteinSpecies Tobacco (Nicotiana tabacum) [TaxId:4097] [101621] (1 PDB entry) 
Domain d1pcva_: 1pcv A: [94493]
Details for d1pcva_
PDB Entry: 1pcv (more details), 2.3 Å
PDB Description: Crystal structure of osmotin, a plant antifungal protein
PDB Compounds: (A:) osmotinSCOPe Domain Sequences for d1pcva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pcva_ b.25.1.1 (A:) Osmotin {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
atievrnncpytvwaastpigggrrldrgqtwvinaprgtkmarvwgrtncnfnaagrgt
cqtgdcggvlqctgwgkppntlaeyaldqfsgldfwdislvdgfnipmtfaptnpsggkc
haihctaningecprelrvpggcnnpcttfggqqycctqgpcgptffskffkqrcpdays
ypqddptstftcpggstnyrvifcp
SCOPe Domain Coordinates for d1pcva_:
Click to download the PDB-style file with coordinates for d1pcva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pcva_:
- d1pcva_ first appeared in SCOP 1.67
- d1pcva_ appears in SCOPe 2.04
- d1pcva_ appears in SCOPe 2.06
- d1pcva_ appears in the current release, SCOPe 2.08
View in 3D
