Lineage for d1pc8b2 (1pc8 B:134-255)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) 
Family b.42.2.1: Ricin B-like [50371] (7 proteins) 
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
duplication: consists of two domains of this foldSpecies European mistletoe (Viscum album) [TaxId:3972] [50375] (11 PDB entries)
different sequence variants
Domain d1pc8b2: 1pc8 B:134-255 [104106]
Other proteins in same PDB: d1pc8a_
complexed with man, nag
Details for d1pc8b2
PDB Entry: 1pc8 (more details), 3.8 Å
PDB Description: crystal structure of a novel form of mistletoe lectin from himalayan viscum album l. at 3.8a resolution
PDB Compounds: (B:) Himalayan mistletoe ribosome-inactivating proteinSCOP Domain Sequences for d1pc8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pc8b2 b.42.2.1 (B:134-255) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpeqnqdqcltsgrds
vaginivscsggssgqrwvftnegailnlknglamdvanpglgqiiiypatgkpnqmwlp
vp
SCOP Domain Coordinates for d1pc8b2:
Click to download the PDB-style file with coordinates for d1pc8b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pc8b2:
- d1pc8b2 first appeared in SCOP 1.69
- d1pc8b2 appears in SCOP 1.71
- d1pc8b2 appears in SCOP 1.75
- d1pc8b2 appears in the current release, SCOPe 2.08
View in 3D
