Lineage for d1pbha_ (1pbh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926592Protein (Pro)cathepsin B [54022] (3 species)
  7. 2926597Species Human (Homo sapiens) [TaxId:9606] [54023] (6 PDB entries)
  8. 2926606Domain d1pbha_: 1pbh A: [37054]

Details for d1pbha_

PDB Entry: 1pbh (more details), 3.2 Å

PDB Description: crystal structure of human recombinant procathepsin b at 3.2 angstrom resolution
PDB Compounds: (A:) procathepsin b

SCOPe Domain Sequences for d1pbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbha_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]}
mrsrpsfhplsdelvnyvnkrnttwqaghnfynvdmsylkrlcgtflggpkppqrvmfte
dlklpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnahvsvevsae
dlltccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrp
pctgegdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvy
sdfllyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgq
dhcgiesevvagiprtd

SCOPe Domain Coordinates for d1pbha_:

Click to download the PDB-style file with coordinates for d1pbha_.
(The format of our PDB-style files is described here.)

Timeline for d1pbha_: