Lineage for d1paqa_ (1paq A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 921850Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 922078Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 922126Protein Translation initiation factor eIF-2b epsilon [101403] (1 species)
  7. 922127Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101404] (1 PDB entry)
  8. 922128Domain d1paqa_: 1paq A: [94413]
    C-terminal domain

Details for d1paqa_

PDB Entry: 1paq (more details), 2.3 Å

PDB Description: crystal structure of the catalytic fragment of eukaryotic initiation factor 2b epsilon
PDB Compounds: (A:) Translation initiation factor eIF-2B epsilon subunit

SCOPe Domain Sequences for d1paqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1paqa_ a.118.1.14 (A:) Translation initiation factor eIF-2b epsilon {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfekegiatveramennhdldtallelntlrmsmnvtyhevriatitallrrvyhfiatq
tlgpkdavvkvfnqwgllfkrqafdeeeyidlmniimekiveqsfdkpdlilfsalvsly
dndiieedviykwwdnvstdprydevkkltvkwvewlqnad

SCOPe Domain Coordinates for d1paqa_:

Click to download the PDB-style file with coordinates for d1paqa_.
(The format of our PDB-style files is described here.)

Timeline for d1paqa_: