Lineage for d1p9sa_ (1p9s A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1129501Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1129546Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 1129547Species Human coronavirus 229E [TaxId:11137] [89348] (3 PDB entries)
  8. 1129551Domain d1p9sa_: 1p9s A: [87999]
    complexed with dio

Details for d1p9sa_

PDB Entry: 1p9s (more details), 2.54 Å

PDB Description: coronavirus main proteinase (3clpro) structure: basis for design of anti-sars drugs
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d1p9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9sa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]}
aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn

SCOPe Domain Coordinates for d1p9sa_:

Click to download the PDB-style file with coordinates for d1p9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1p9sa_: