Lineage for d1p9pa_ (1p9p A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. Protein tRNA(m1G37)-methyltransferase TrmD [89630] (3 species)
  7. Species Escherichia coli [TaxId:562] [110499] (1 PDB entry)
    Uniprot P07020
  8. Domain d1p9pa_: 1p9p A: [104092]
    complexed with sah

Details for d1p9pa_

PDB Entry: 1p9p (more details), 2.5 Å

PDB Description: the crystal structure of a m1g37 trna methyltransferase, trmd
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d1p9pa_:

Sequence, based on SEQRES records: (download)

>d1p9pa_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Escherichia coli [TaxId: 562]}
mwigiislfpemfraitdygvtgravkngllsiqswsprdfthdrhrtvddrpygggpgm
lmmvqplrdaihaakaaagegakviylspqgrkldqagvselatnqklilvcgryegide
rviqteideewsigdyvlsggelpamtlidsvsrfipgvlgheasatedsfaeglldcph
ytrpevlegmevppvllsgnhaeirrwrlkqslgrtwlrrpellenlalteeqarllaef
ktehaq

Sequence, based on observed residues (ATOM records): (download)

>d1p9pa_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Escherichia coli [TaxId: 562]}
mwigiislfpemfraitdygvtgravkngllsiqswsprdfthdrhrtvddrpygggpgm
lmmvqplrdaihaakaaagegakviylspqgrkldqagvselatnqklilvcgryegide
rviqteideewsigdyvlsggelpamtlidsvsrfipgvlgeglldcphytrpevlegme
vppvllsgnhaeirrwrlkqslgrtwlrrpellenlalteeqarllaefktehaq

SCOPe Domain Coordinates for d1p9pa_ are not available.

Timeline for d1p9pa_: