Lineage for d1p97a_ (1p97 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922630Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1922804Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 1922805Protein Hypoxia-inducible factor Hif2a, C-terminal domain [103185] (1 species)
    endothelial pas domain protein 1, EPAS-1
  7. 1922806Species Human (Homo sapiens) [TaxId:9606] [103186] (1 PDB entry)
  8. 1922807Domain d1p97a_: 1p97 A: [94382]

Details for d1p97a_

PDB Entry: 1p97 (more details)

PDB Description: nmr structure of the c-terminal pas domain of hif2a
PDB Compounds: (A:) Endothelial PAS domain protein 1

SCOPe Domain Sequences for d1p97a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gamdsktflsrhsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnl
ctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn

SCOPe Domain Coordinates for d1p97a_:

Click to download the PDB-style file with coordinates for d1p97a_.
(The format of our PDB-style files is described here.)

Timeline for d1p97a_: