Lineage for d1p8kz1 (1p8k Z:1-125)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662475Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1662486Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 1662487Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 1662488Protein DNA endonuclease I-AniI [103141] (1 species)
    duplication: contains tandem repeat of this fold
  7. 1662489Species Emericella nidulans (Aspergillus nidulans) [TaxId:162425] [103142] (2 PDB entries)
    synonym: Emericella nidulans
  8. 1662492Domain d1p8kz1: 1p8k Z:1-125 [94361]
    complexed with mg

Details for d1p8kz1

PDB Entry: 1p8k (more details), 2.6 Å

PDB Description: The structure and DNA recognition of a bifunctional homing endonuclease and group I intron splicing factor
PDB Compounds: (Z:) Intron-encoded endonuclease I-AniI

SCOPe Domain Sequences for d1p8kz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8kz1 d.95.2.1 (Z:1-125) DNA endonuclease I-AniI {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
gsdltyaylvglfegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrk
rneiemvalrirdknhlksfilpifekypmfsnkqydylrfrnallsgiisledlpdytr
sdepl

SCOPe Domain Coordinates for d1p8kz1:

Click to download the PDB-style file with coordinates for d1p8kz1.
(The format of our PDB-style files is described here.)

Timeline for d1p8kz1:

1662492
d1p8kz1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1p8kz2