SCOPe 2.08: Domain d1p8ja1: 1p8j A:443-578

Lineage for d1p8ja1 (1p8j A:443-578)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)
Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins)
a truncated form of this fold lacking one of the N-terminal strands
Protein Furin, C-terminal domain [89252] (1 species)
Species Mouse (Mus musculus) [TaxId:10090] [89253] (1 PDB entry)
Domain d1p8ja1: 1p8j A:443-578 [87946]
Other proteins in same PDB: d1p8ja2, d1p8jb2, d1p8jc2, d1p8jd2, d1p8je2, d1p8jf2, d1p8jg2, d1p8jh2
complexed with ca, nag, so4

Details for d1p8ja1

PDB Entry: 1p8j (more details), 2.6 Å

PDB Description: crystal structure of the proprotein convertase furin

PDB Compounds: (A:) Furin precursor

SCOPe Domain Sequences for d1p8ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8ja1 b.18.1.20 (A:443-578) Furin, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
tvapqrkciveilvepkdigkrlevrkavtaclgepnhitrlehvqarltlsynrrgdla
ihlispmgtrstllaarphdysadgfndwafmtthswdedpagewvleientseannygt
ltkftlvlygtapegl

SCOPe Domain Coordinates for d1p8ja1:

Click to download the PDB-style file with coordinates for d1p8ja1.
(The format of our PDB-style files is described here.)

Timeline for d1p8ja1: