Lineage for d1p8fa_ (1p8f A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155664Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2155665Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2155666Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2155728Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 2155732Species Escherichia coli [TaxId:562] [53669] (27 PDB entries)
  8. 2155737Domain d1p8fa_: 1p8f A: [87943]
    complexed with gol, ict, mg, so4

Details for d1p8fa_

PDB Entry: 1p8f (more details), 1.85 Å

PDB Description: a four location model to explain the stereospecificity of proteins.
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d1p8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8fa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]}
meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOPe Domain Coordinates for d1p8fa_:

Click to download the PDB-style file with coordinates for d1p8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1p8fa_: