![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
![]() | Domain d1p85n_: 1p85 N: [87883] 50S subunit fit in the cryo-EM map of 70S ribosome |
PDB Entry: 1p85 (more details), 12.3 Å
SCOPe Domain Sequences for d1p85n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p85n_ i.1.1.1 (N:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d1p85n_: