Lineage for d1p7da_ (1p7d A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999834Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2999835Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2999836Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2999907Protein Integrase (Int) [56353] (2 species)
  7. 2999908Species Bacteriophage lambda [TaxId:10710] [56354] (5 PDB entries)
  8. 2999913Domain d1p7da_: 1p7d A: [94219]
    protein/DNA complex
    has additional subdomain(s) that are not in the common domain

Details for d1p7da_

PDB Entry: 1p7d (more details), 2.95 Å

PDB Description: Crystal structure of the Lambda Integrase (residues 75-356) bound to DNA
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1p7da_:

Sequence, based on SEQRES records: (download)

>d1p7da_ d.163.1.1 (A:) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
egkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiyqaae
sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik

Sequence, based on observed residues (ATOM records): (download)

>d1p7da_ d.163.1.1 (A:) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
mtlhswldryekilasrgikqktlinymskikairrglpdaplttkeiaamlngyidegk
aasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiyqaaessp
cwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgismk
etldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrslsar
lyekqisdkfaqhllghksdtmasqyrddrgrewdkieik

SCOPe Domain Coordinates for d1p7da_:

Click to download the PDB-style file with coordinates for d1p7da_.
(The format of our PDB-style files is described here.)

Timeline for d1p7da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p7db_