Lineage for d1p6ta1 (1p6t A:1-72)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196857Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2196954Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species)
    duplication: contains tandem repeat of two HMA domains in the N-terminal region
  7. 2196955Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries)
  8. 2196957Domain d1p6ta1: 1p6t A:1-72 [94188]
    Other proteins in same PDB: d1p6ta3

Details for d1p6ta1

PDB Entry: 1p6t (more details)

PDB Description: structure characterization of the water soluble region of p-type atpase copa from bacillus subtilis
PDB Compounds: (A:) Potential copper-transporting ATPase

SCOPe Domain Sequences for d1p6ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
qekieklgyhvv

SCOPe Domain Coordinates for d1p6ta1:

Click to download the PDB-style file with coordinates for d1p6ta1.
(The format of our PDB-style files is described here.)

Timeline for d1p6ta1: