Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species) |
Species Flavobacterium sp. atcc 27551 [TaxId:74567] [102087] (2 PDB entries) identical sequence to the Pseudomonas diminuta PTE |
Domain d1p6bb_: 1p6b B: [94164] complexed with ebp, efs, zn; mutant |
PDB Entry: 1p6b (more details), 1.9 Å
SCOPe Domain Sequences for d1p6bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p6bb_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Flavobacterium sp. atcc 27551 [TaxId: 74567]} gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa aifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallg irswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvi pflrekgvpqetlagitvtnparflsptlra
Timeline for d1p6bb_: