![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (2 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (4 proteins) |
![]() | Protein Chaperone protein Caf1m [89205] (1 species) |
![]() | Species Yersinia pestis [TaxId:632] [89206] (4 PDB entries) |
![]() | Domain d1p5va1: 1p5v A:7-147 [87812] Other proteins in same PDB: d1p5va2, d1p5vb_ |
PDB Entry: 1p5v (more details), 1.7 Å
SCOP Domain Sequences for d1p5va1:
Sequence, based on SEQRES records: (download)
>d1p5va1 b.1.11.1 (A:7-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} faskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpp lfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdv gvfvqfainncikllvrpnel
>d1p5va1 b.1.11.1 (A:7-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} faskeygvtigesriiypldaagvmvsvkntqdypvliqsriydpfvvtpplfrldakqq nslriaqaggvfprdkeslkwlcvkgipkdvgvfvqfainncikllvrpnel
Timeline for d1p5va1: