Lineage for d1p53a2 (1p53 A:185-282)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 657024Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)
  7. 657025Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries)
  8. 657035Domain d1p53a2: 1p53 A:185-282 [94119]
    Other proteins in same PDB: d1p53a1, d1p53b1

Details for d1p53a2

PDB Entry: 1p53 (more details), 3.06 Å

PDB Description: the crystal structure of icam-1 d3-d5 fragment
PDB Compounds: (A:) intercellular adhesion molecule-1

SCOP Domain Sequences for d1p53a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p53a2 b.1.1.4 (A:185-282) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
fvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfs
akasvsvtaedegtqrltcavilgnqsqetlqtvtiys

SCOP Domain Coordinates for d1p53a2:

Click to download the PDB-style file with coordinates for d1p53a2.
(The format of our PDB-style files is described here.)

Timeline for d1p53a2: